DPCstruct | MC39546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 86 ± 5 aa |
| Standard deviation of domain lengths | 5.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2HUJ2 | 146-230 | LPAEDALAVVRGRIAGEDLGSYPVDRLQADRLRDGWRVWAVPPVSDDPLDVRLGWAVWYVADDGVVWRSSTSTDFGVAEQRLTDQ |
| A0A4S8PY58 | 1-88 | MNETEAIDRVRAYIHGKYPDYPTDNLVAERFEVGWTVFPQSDPEDFGSLRIGQTIFLIGDSGIIMETSSSLPPGQPEAEFTRLHGTGS |
| A0A4R2JBU0 | 1-84 | None |
| A0A1A3EN78 | 353-448 | None |
| A0A1A2B9S3 | 1-86 | None |
| A0A7G1KW57 | 142-230 | None |
| A0A846WLM5 | 154-232 | None |
| A0A841FHK6 | 18-103 | None |
| H6N1W8 | 59-136 | None |
| A0A0L8NWD7 | 110-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.