DPCstruct | MC3954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 126 ± 8 aa |
| Standard deviation of domain lengths | 8.13 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1DLA5 | 79-193 | IDYPEFVCIYCGLPGDGKDHLLPKPNTGEALRKYVLVVPSCGECNGFINDFPDPHVGRRRILAQQKIAKKNRHLLERKEKSEAELNE… |
| A0A0S8DMG9 | 5-139 | RRKAFLMDDCAYDIMGREGDPCVYCGQESSGHDHVPPLAYISKLDEETKNHLNLRKFPACRECNSILGDILLKDIRSRRAYVHEKLR… |
| A0A6M3LL27 | 9-144 | None |
| A0A3N2CWA1 | 76-191 | None |
| A0A2W4CBI5 | 17-160 | None |
| A0A259L3T7 | 3-132 | None |
| A0A7C1R401 | 2-135 | None |
| A0A024HF74 | 16-143 | None |
| A0A7W4CHC1 | 3-128 | None |
| A0A1A6L198 | 3-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.