DPCstruct | MC39537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 211 ± 30 aa |
| Standard deviation of domain lengths | 29.86 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.38 |
| Pfam Score | 87.27 |
| Assigned Pfam label(s) | PF05141- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7YXC6 | 161-398 | KGLKDKYGKPGYEENFDKLKLKDNKMNTTYLGLKKFMSHDQKHVLAQLSYKQRRLRLSEIAKGMMVQGKALDNFLNDKFSDCIRLSI… |
| W7E2U5 | 1-232 | MHRYGAFDWDAFTNESYVKDDENRRLTYCGYMKFLSLDLANTYLIGLGRTKSTFERGVEVIAKSMLKRENKISINILPVQKLLTLWH… |
| A0A6M7YKT0 | 202-440 | None |
| A0A821N3Z9 | 27-282 | None |
| A0A2P6NEW3 | 208-446 | None |
| A0A2A2KCT1 | 152-348 | None |
| A0A3N4L1Y3 | 251-410 | None |
| A0A1B7Y7N7 | 808-1015 | None |
| A0A4Z1P0Z1 | 217-430 | None |
| A0A395NTC5 | 291-488 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.