DPCstruct | MC3953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 72 ± 10 aa |
| Standard deviation of domain lengths | 9.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251WNJ9 | 3-68 | FLEDSRASLALRNFYMNRDFRDGAGRAKSEEWAQGFLFDYRSGYTEGTLGVGLDLLGKLGVRLDSG |
| A0A4P6GS82 | 2-64 | AEMDKATVLMRNFYYNHDLRDSNAPAQSKIEEWAQGFILKAESGYTEGLVGFGLDMYTGLGIV |
| A0A2S6IZU3 | 21-88 | None |
| A0A2V2KYK6 | 4-76 | None |
| A0A6N0LGZ0 | 1-77 | None |
| A0A6N3UCU1 | 2-73 | None |
| A0A0P9QZE0 | 26-114 | None |
| A0A1I8ACV7 | 1-78 | None |
| A0A5E7AWC3 | 23-87 | None |
| A0A6I6Y991 | 2-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.