DPCstruct | MC39523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 96 ± 13 aa |
| Standard deviation of domain lengths | 13.32 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4PQX8 | 13-102 | SRTRTDYSRLEDQLIVDWILKHQKAELVKGNSIWREIEPYHLIITGIKRSWQSLRNRYIRSILPFLHNYSVTAQQASELRAGAATGS… |
| A0A7R9IJW6 | 1-76 | MPFLAIYSRQEDVSILEYITQHQAYAHIGGVMLWRQMEENMGSTRTWQSLKEHFLKKVLPNIESYHLSCERVRAFR |
| V4ATM5 | 33-137 | None |
| A0A834MIW6 | 1-103 | None |
| J9KSL6 | 239-346 | None |
| A0A6P7F9N8 | 1-98 | None |
| A0A5N4AFH1 | 1-108 | None |
| A0A1Y1NEX9 | 1-93 | None |
| A0A482WPV5 | 322-398 | None |
| D6WAY9 | 87-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.