DPCstruct | MC39518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 120 ± 9 aa |
| Standard deviation of domain lengths | 9.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395IIN8 | 226-335 | LAYTTLFTASCLKDSSNGAYCYAQAVTNSSSPTDSYIYYLPLNVSLPGGSQPTCNECLKTTMAVFEQAGSVRTSAIAGTYIQAAGQI… |
| A0A4Q4VZG5 | 10-133 | ATCLQDRDTDTAAYCFANAVTNLTTSSNVYLYYLPLNSTYPQRAEPSCNSCTRDTMAILQSDTSDRSSSIASTYEGAALRINEVCGP… |
| A0A0C2X7C0 | 32-163 | None |
| A0A3S4D527 | 106-222 | None |
| A0A1C7LS10 | 378-507 | None |
| M5G9B2 | 190-313 | None |
| A0A218YUA9 | 508-638 | None |
| A0A2X0NGX6 | 370-497 | None |
| A0A1D2JIF5 | 264-389 | None |
| A0A3M7E5Y2 | 49-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.