DPCstruct | MC3951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 142 ± 18 aa |
| Standard deviation of domain lengths | 18.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A3J5P8 | 15-150 | WGVSQEIAVAKYAGGGDWYANPTSLPNLVKFCNQNINTTLNTKVGTVEVGSAEIFTYPFIHMTGHGNVVFSANDVINLRNYLTSGGF… |
| A0A0S7WXV3 | 55-190 | VLFLARGLEPIIINKLQRTGDWNNTPHDAQHVVEHIEHHFQKGVQWRIVTLDAPMELLLKTPILYITGGQKLILSEAEKAKLKSYVE… |
| A0A7C1PVJ3 | 51-181 | None |
| A0A3M1E946 | 1-128 | None |
| A0A7C7V4Q1 | 120-263 | None |
| A0A7V0YTF1 | 40-190 | None |
| A0A5Q4FC39 | 8-141 | None |
| A0A0S7YAG3 | 118-249 | None |
| A0A2D7HE95 | 57-222 | None |
| A0A7C3WE55 | 261-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.