DPCstruct | MC39508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 278 ± 40 aa |
| Standard deviation of domain lengths | 39.94 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257YHY1 | 2-283 | DEGRLRALSDSFTAYLTAARDAGRVDVTPGRFLLPGDLAGSPVLTFAPLPKPAHTPRACLWREMERRFEAYKSRVVRPFFRDHFARI… |
| A0A541BXS7 | 243-558 | DYPGEWLLDLPLLGRSFEAWSAAELARAEEAPRAGHAAAWRAALAGLDPQAPTEHATLARLAEAYTAYLRRCRDEAGLAALTPGRFL… |
| A0A037UXR5 | 6-319 | None |
| A0A7C5N2G9 | 157-431 | None |
| A0A378C9H0 | 2-209 | None |
| A0A378N563 | 10-208 | None |
| A0A3M1HN97 | 177-483 | None |
| A0A6G9VWU9 | 62-330 | None |
| A0A0A2VEU6 | 2-242 | None |
| A0A258JMA4 | 53-373 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.