DPCstruct | MC3950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 157 |
|---|---|
| Mean domain length (aa) | 130 ± 19 aa |
| Standard deviation of domain lengths | 18.81 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9JQ91 | 32-175 | KEVDAFPVYQGQVSCDPVAKPGVLAARRLLLAKFGGGSGGITRACSSGGLSEHKEGRAWDWSLRASRAKDRRIAKRATGWLTRSVEG… |
| A0A6H1F2A6 | 1-75 | MAVDFMVPVNSAQGDQLAEYLTKHMDELGVYYIIWKQKYYMTQNNIYGPANTWNIMPDRGGVTANHYDHVHVSFK |
| F5XSN1 | 8-123 | None |
| A0A6G3V982 | 3-91 | None |
| A0A1Q9STR1 | 68-196 | None |
| A0A1I4YK46 | 3-149 | None |
| A0A7V8VJE2 | 8-156 | None |
| A0A496PMV6 | 5-128 | None |
| A0A419HC96 | 27-193 | None |
| A0A2S8BKT3 | 16-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.