DPCstruct | MC395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 124 ± 11 aa |
| Standard deviation of domain lengths | 11.31 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0VJB4 | 167-291 | RRSASPQFVPLSTPPAPKKQRANRITLNQIQAWHAACTEAFKDKTAMRAFPEPPTEPCSDLTCASTSRTLKACKCNIKKCFVGRSTL… |
| A0A1V8TH76 | 403-516 | KWQNTSAPVSDPVQHWYTYAQRALANYSQLTAFPAPPVIVRCSSMACASSGHTLQACECNVRATLERLNVDQLSRVRRSFHPDRFSA… |
| A0A6A6CHF2 | 217-338 | None |
| A0A2I0RM22 | 268-398 | None |
| A0A4U0WQH6 | 130-261 | None |
| A0A0F4GZN6 | 214-355 | None |
| A0A0F4GWA3 | 524-629 | None |
| A0A0F4GPI8 | 856-990 | None |
| A0A1V8SBP9 | 272-380 | None |
| N1PJW7 | 86-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.