DPCstruct | MC39498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1392 |
|---|---|
| Mean domain length (aa) | 187 ± 31 aa |
| Standard deviation of domain lengths | 30.92 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.37 |
| Mean intra-cluster sequence similarity (%) | 11.27 |
| Pfam Score | 76.33 |
| Assigned Pfam label(s) | PF07833- PF04526- PF00223- CL0559- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9K7Y3 | 10-199 | EIDSEFGEPPIIDGYIDPSVQEWNEAIKNQAYIDDLPIELWVMQTAQNLYISIQLDLLPIARNSSEFIGLIISNSSSENIDDFIDAK… |
| A0A7C2YXD4 | 6-173 | AERGLFDLLRYAVYDADDRWQLAFEFPTLPNAWNGPQGFSHPILYLYFDVGPGGSTAAHEEGKAAQVAFSPDRPWDYFVKVAGWPAY… |
| A0A226EK45 | 186-325 | None |
| A0A239JI75 | 1-203 | None |
| A0A3M1E340 | 283-493 | None |
| A0A1G3LGE0 | 786-969 | None |
| A0A7C1HVA8 | 25-240 | None |
| A0A7R9A7P0 | 318-489 | None |
| A0A1W9N9I6 | 56-278 | None |
| A0A1H1VVW6 | 115-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.