DPCstruct | MC39497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 164 |
|---|---|
| Mean domain length (aa) | 341 ± 82 aa |
| Standard deviation of domain lengths | 82.26 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 86.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.35 |
| Pfam Score | 98.86 |
| Assigned Pfam label(s) | CL0028- PF15836- PF00909 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9K4A6 | 205-547 | GHVYGGAGSGGEGGIIGNLDKAFLRGVDLNTPFGDGAIPEYLFFAYQMMFAIITPALITGAFANRIRFPAYLMFLIAWLILVYFPFV… |
| A0A525VRI8 | 2-250 | GALDFAGGAVVHVSSATSALVACIMLGKRMGYPNTAMPPHNLPIMLLGAGLLWFGWFGFNAGSALGANGLAASAFVATHIAASVATV… |
| A0A2E8L9J3 | 28-340 | None |
| A0A1Q9DZC1 | 237-660 | None |
| A0A812PNP9 | 476-867 | None |
| A0A2U3DQW9 | 268-698 | None |
| A0A3Q4MLF3 | 56-273 | None |
| A0A221LEJ2 | 14-335 | None |
| A0A6A3AP73 | 33-270 | None |
| A0A1I8IJK6 | 510-940 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.