DPCstruct | MC39493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 221 ± 23 aa |
| Standard deviation of domain lengths | 23.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M2ZFU8 | 1-245 | MGVGPRSKSRLDDSAVLTHSLVDTHVTWAKSRGYADTMAQRVLQLMSDYGVDDCPLWHQRSETEVGLASAEELGLSRELRADLRDWN… |
| A0A2U9NVQ3 | 7-225 | PRHLLVRAHGGASPLSTTAPGASADPEEFVYEVALDDPRLGLPDGLAERLRGWDRARPGGGFTDRPALRRHAERGLAAAQDLARHLG… |
| A0A5C5RPK2 | 1-250 | None |
| A0A4Y9M512 | 3-186 | None |
| A0A4R1TVE3 | 4-203 | None |
| H5URD7 | 1-248 | None |
| A0A2C8X756 | 4-239 | None |
| A0A496LYN7 | 3-202 | None |
| A0A6P0H9K5 | 9-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.