DPCstruct | MC3949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 96 ± 5 aa |
| Standard deviation of domain lengths | 4.82 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W3R8T2 | 35-129 | SVGFPVPQGGFTATLLPLDRPGGGLTLTSRSDLAHPGHYLTFVDPQTRDLTTLAVHGFSEHLDVYVENGELKAEHAFQLFGTPFMTL… |
| A0A7Y9F4Y8 | 1-95 | MHVAFPLEHGNVQVFLRPEVGPGGSLVLRSPSRAFGGDGCYVTVRHRGRTFAARAPVRERFHVHVDDEGVLRTDHHLSLWSARAVSL… |
| A0A397LW60 | 191-284 | None |
| A0A6F8XPD6 | 1-96 | None |
| A0A366XYC3 | 62-151 | None |
| A0A2I2KV93 | 242-337 | None |
| A0A543CQK5 | 151-246 | None |
| A0A535ZM84 | 71-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.