DPCstruct | MC39488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 104 ± 23 aa |
| Standard deviation of domain lengths | 22.99 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 26.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P9D1K1 | 1-110 | MQMQNGMSEKDVVNMILADEKRTAGEYATATLEANCQTVHSTFNQLLQNTLKTQRQVFEVMQQQGWYSAPSTAMSQDVQKQVQQAQQ… |
| A0A2K9E283 | 1-78 | MQEKEMVNDLLNQLKSSLTTYAHAISESSNPQLRQTLQQIRNNCETFQYDLYKLAEQKGFYHAAQKAEPSEIMQVRSQ |
| A0A1K1R4X1 | 7-121 | None |
| A0A2L2X835 | 15-115 | None |
| A0A4Z0RC98 | 2-79 | None |
| A0A0U1KUJ4 | 9-101 | None |
| A0A7W5B4N3 | 1-170 | None |
| M1PWH5 | 1-111 | None |
| A0A7C3UVP6 | 1-71 | None |
| A0A2R4MYN5 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.