DPCstruct | MC39487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 139 |
|---|---|
| Mean domain length (aa) | 163 ± 35 aa |
| Standard deviation of domain lengths | 35.19 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W1E324 | 24-168 | MAGVPVGGVWAKVSCEKVVFDRQSWGFNSATHRVRMLAGKGQSRGGRTFKDEYTGQVLALNVVGKAGKKLANAHVDHVVPLKYMHDN… |
| A0A7X3ZIK1 | 3-119 | HRIVERQGGRIWSPYTDREFDSIKETDIEHIVAAAEAHDSGLCARPAEDRKKFARDLENLTLASPKVNRWQKSDKDAAEWLPEHHRC… |
| A0A2U1W2X0 | 65-246 | None |
| A0A6J6QM82 | 89-286 | None |
| A0A2E9EF98 | 37-248 | None |
| A0A838YLA8 | 603-774 | None |
| A0A6N8W057 | 87-201 | None |
| A0A6B1GFV1 | 113-265 | None |
| A0A7K2AKH5 | 272-468 | None |
| A9WNA6 | 100-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.