DPCstruct | MC39483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 227 ± 25 aa |
| Standard deviation of domain lengths | 25.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6DZL5 | 17-219 | PGSALAVNHAKFIKGPINEPQDVTRQCLKCHKDEATDFMKTAHWRWSLEQKVDGKTVDRGKKNALNNYCTSVAGNEQFCAKCHAGYG… |
| Q64BJ9 | 2-211 | CHQQEGEDFATSIHNTWMGEATHVVGKEGKMTGKLVGINDFCIAVKSNEALCGKCHAGYGLSEHDFSVGKIDCLICHAPNYKKTASC… |
| A0A7C7QQ67 | 401-598 | None |
| A0A497DA43 | 1-250 | None |
| A0A661ED15 | 1-231 | None |
| A0A7V4HSI9 | 45-280 | None |
| A0A1F3XXM5 | 92-299 | None |
| A0A662R3I8 | 48-270 | None |
| A0A2N6ETN8 | 324-518 | None |
| X1B7H5 | 1-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.