DPCstruct | MC3948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 184 ± 27 aa |
| Standard deviation of domain lengths | 26.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.71 |
| Pfam Score | 81.67 |
| Assigned Pfam label(s) | CL0271- PF00173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1DRY7 | 5-169 | SPLRSLTPELLVHALSFADAVSLLAASRACAALRAAANEEQVWTALLWRHHSRILRLLFHGQPPRENDGLSPKQAYFEFARSWKLLA… |
| R1BC88 | 19-229 | DARPDNMTMDQRLPHDLLLSVAANLGPAALLVLSQVSRACNDAANAPQLWRKLLECELKAQAHLFFGGTLPPPSASVGWKRHFFVLR… |
| A0A482SPR7 | 95-262 | None |
| A0A812IDA8 | 60-282 | None |
| R1F0M6 | 5-147 | None |
| A0A7S0LK48 | 18-177 | None |
| A0A7S3Z994 | 62-235 | None |
| A0A7S3T135 | 16-247 | None |
| A0A7S1UFE8 | 187-393 | None |
| R1CPV1 | 1-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.