DPCstruct | MC39476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 150 ± 16 aa |
| Standard deviation of domain lengths | 16.33 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4HPH9 | 443-576 | VGPPPAVLPYQVDLVAGEPNEVLGESEDDFYGRQGRLIQYAHGNADGVTTRDTWINSLDAGTRGCVDADPIQVDDRTASVSVTVADG… |
| M0MLP9 | 25-168 | GDGATGETYYQVDFVVGEPIENLRGPNGTYRNDELLRFAHGSTAEPITRRSEGEFITDESMADRIESRNITVENGTATTTFTVADGE… |
| A0A6B0TCK7 | 42-176 | None |
| A0A3A5JP71 | 520-661 | None |
| V4J1P6 | 2-159 | None |
| V4HH16 | 627-777 | None |
| M0MCP5 | 110-278 | None |
| A0A830FGE2 | 159-347 | None |
| M0M899 | 83-239 | None |
| A0A2R6DSV3 | 121-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.