DPCstruct | MC39468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 172 ± 23 aa |
| Standard deviation of domain lengths | 22.85 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4RNY4 | 9-193 | TEHCILPVSAESQPLFPAKMVSRLMQWTASTYDEYKVLPYTRPVVEAGLAQESDLYFSALIERGTAKLRVAVLLSPSFPSPAPILSL… |
| A0A0S7LHR0 | 2-131 | AVVERGTARLHAAVVLSPRYPEVSPLFSLSLNWKGECSGRSDDNLRAVESEVNVFKNELQGPKPGHQLLTNQIARLCVCLDVYLETE… |
| A0A0C2J6X4 | 350-532 | None |
| A0A7R9AWM5 | 465-654 | None |
| A0A7D9MER1 | 2-179 | None |
| D8LF18 | 501-737 | None |
| V5H8E4 | 149-332 | None |
| W2SZU4 | 319-488 | None |
| A0A0B2W5M6 | 1-139 | None |
| A0A7S0MXK4 | 3-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.