DPCstruct | MC39467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 122 ± 16 aa |
| Standard deviation of domain lengths | 16.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 65.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 59.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15245 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673IJM1 | 101-204 | RQQNRPSVITCAPASNRPCSLSSCHMSPNSCTSGSTNKTKANTVCDPVIEEHFRRSLGKVYKEPVPVSNSVSITGSVDDHFTKALGD… |
| A0A0S7L4Q1 | 77-189 | MSGTAERQQNRPSVITCAPANNRNCNLSHCHMNGCTPPPPDDQRKTNAETECDTNIEEHFRRSLGKNYKEAEAVSNSVSITSSVDDH… |
| A0A3B4AVQ8 | 142-243 | None |
| Q5BJP0 | 150-287 | None |
| A0A2G9S2D2 | 39-175 | None |
| A0A6P4Y9N6 | 117-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.