DPCstruct | MC39464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 125 ± 26 aa |
| Standard deviation of domain lengths | 26.25 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 48.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4RIG6 | 1-112 | MADLREVADLLWGSGGSRVADAVFRRWTQGFVFSEDEPTALEQFEGGPCAVIVPVQAFLLKNALFGSENINWKECSEDERRLLLCHG… |
| A0A817RV05 | 18-103 | ELIKIVWGDKIEESIFERWSQPFEFSTDERSALIQYEGGPCSVLTTVQAHLLNELIFCRRCLNDWRQASNDEIDLHFLNALVSILH |
| A0A6P6R579 | 1-137 | None |
| A0A6A5FDT7 | 1-140 | None |
| A0A7J8E931 | 2-137 | None |
| B4HB58 | 108-263 | None |
| A0A444U1Y6 | 1-103 | None |
| A0A384B9X9 | 1-137 | None |
| A0A3N0XRQ3 | 5-152 | None |
| A0A816FE43 | 17-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.