DPCstruct | MC39462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 125 ± 23 aa |
| Standard deviation of domain lengths | 23.49 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4RGB8 | 15-139 | AVPVLVSAEPAVSKALPFKNPSFTHSGLGGMGVRKSRVWKNLKQIIAAERSMNWSPDDATYSNIDAPPSFKPAKKYSDLSGLPASYT… |
| A0A182MF17 | 3-89 | KKRQWKSLKQILTHEKTLPWKETDITFNAPPSLKPAKKYSDISGLIAPYTDPHSKLRYHNVEEYQTIRTFPMDLTAGYLALRGYAPS |
| A0A0E0GYD9 | 1-128 | None |
| A0A5J5EQ74 | 26-149 | None |
| A0A364MYB2 | 1-190 | None |
| A0A370TBN7 | 50-187 | None |
| D3BJT9 | 226-344 | None |
| Q6FLR9 | 18-127 | None |
| A0A4U0VJU6 | 62-191 | None |
| A0A6A6Z2G0 | 40-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.