DPCstruct | MC3946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 135 ± 17 aa |
| Standard deviation of domain lengths | 17.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3X396 | 10-152 | GGGGGVKRSRRGSVKAASSVVLTRGLAPGMVRLACGETHVSVSEAHLGKLWALYARSRPSPMPPAAAERFPEVAFCVVARQLSLQGG… |
| A0A0S7GJ11 | 148-274 | PTPALPRVELHFENDVACLRFRGEMVKVNRGHFSKLELLYRYSCIDDPRFEKFLARVWCLLKRYQVMFGSGANEGSGLQGALPVAVF… |
| A0A2E0ILZ5 | 65-183 | None |
| A0A7S1FGF8 | 62-187 | None |
| A0A034V903 | 233-394 | None |
| A0A5J4YXS3 | 147-267 | None |
| T1PL29 | 33-188 | None |
| C1MLJ5 | 194-335 | None |
| A0A1S3IWL0 | 217-356 | None |
| D2V319 | 489-624 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.