DPCstruct | MC39459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 841 |
|---|---|
| Mean domain length (aa) | 221 ± 44 aa |
| Standard deviation of domain lengths | 43.76 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.85 |
| Pfam Score | 57.14 |
| Assigned Pfam label(s) | PF06119- PF01826- CL0692- PF08742- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4RE12 | 16-267 | YRPPFYAILIGDPHITTLDNVSYTFNGLGEYTILEVFTNNVTSFTMQGRTGIASANASANVTTKATSFIAIVAQQIGDYKVRTRIAN… |
| A0A058ZF71 | 295-480 | IPDGSGEQDPHFSAFHGRQYYFEGRSGHSYNIISDKTFQVNAHFIRLEALKGTYMGRLGFLIGSHVLGFDPGFGAFLNGQQLPVGSL… |
| G0P761 | 4-271 | None |
| G0PNU7 | 360-561 | None |
| A0A0D8XM05 | 481-780 | None |
| A0A6P1AFG4 | 618-902 | None |
| A0A669D7Q5 | 514-730 | None |
| A0A226F3Y3 | 441-600 | None |
| A0A803Q0F7 | 971-1198 | None |
| A0A812KFV4 | 32-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.