DPCstruct | MC39456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 132 ± 16 aa |
| Standard deviation of domain lengths | 16.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4RC47 | 1-125 | LTCSHCRVRAGVDEVELSEDLYTRDHVRVYGMRNHLVADPWDATSVYYVDRAGRVQRVRVALDTYLGTPVPVFRLAREVAGSPGRVS… |
| R7UVD4 | 2-122 | CQRPEVLKLSERQYSLQHVKAFGLHNHLILDPWNKNCVFYVDSQWKICLVSIDENSRASEACPVLAVPDSSYKKNVPDRLCMTLEFI… |
| A0A2T7NIB0 | 1-130 | None |
| H3AMR4 | 1-114 | None |
| Q5D8J7 | 1-154 | None |
| A0A3Q1FQY6 | 5-158 | None |
| A0A3B5MV40 | 4-158 | None |
| A0A2R7X6G0 | 12-126 | None |
| A0A7R9FMG0 | 7-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.