DPCstruct | MC39452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 203 ± 10 aa |
| Standard deviation of domain lengths | 10.41 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 66.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4R9R6 | 20-209 | APTQSDLHPELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKFSTSRGKPGWGKETCRPMWWPPEVPWANVRSDVRSEDQKQRVSWTHA… |
| A0A6J8D1P2 | 4-206 | ESGPPPDIDMASELPPLSVDTMSQVQLTEFIPHLVCLVTGREQPYFGKNQYKPVWWPDGVAWTTPDEDSDNTLALQIQAQELRAVVR… |
| A0A182QZK7 | 1-216 | None |
| A0A6A4VBA3 | 142-341 | None |
| C3ZSH5 | 61-274 | None |
| A0A8B6DFZ2 | 67-250 | None |
| A0A7R9C0V0 | 101-317 | None |
| A0A6P5A670 | 61-266 | None |
| K1QXZ9 | 147-342 | None |
| A0A2R7WBB0 | 1-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.