DPCstruct | MC39450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 132 ± 24 aa |
| Standard deviation of domain lengths | 23.50 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4R972 | 3-114 | QIVLLVILLLAIANFLIGTFIPPTEEKKSRGYFGYQAKIFSENMGPDFQNGETFFSVFAIFFPAATGILAGANISGDLADPQAAIPR… |
| A0A402E815 | 38-151 | AQIVFFFVILLSFISYFIGTILPASEEQQSKGYFSYKTEIFLQNMVPDWRGEDGSFFSMFSIFFPSATGILAGANISGDLKDPAVAI… |
| A0A0S7J654 | 6-173 | None |
| Q4T708 | 7-158 | None |
| A0A812U5Y4 | 106-228 | None |
| A0A0S7L805 | 90-210 | None |
| A0A3B5M7I6 | 77-247 | None |
| A0A0S7J5P8 | 226-388 | None |
| A0A7T8KGP6 | 22-148 | None |
| A0A167EDJ8 | 7-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.