DPCstruct | MC3945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 249 ± 16 aa |
| Standard deviation of domain lengths | 16.01 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4LLK6 | 14-271 | CGVEFPEDSEGKRPTTEINRETFAVAIEAIRPDLAEKVRAEKKWRFKYTKHVVDQVEASLQTPEAALDVAKAGLQYLHYTMEFLRDD… |
| A0A7S3WEI5 | 66-323 | PPKAPVGAEFPEDSKGGRSTSEAGKKAFAAAIGGSGVGEAEAAAAKCAGERSWRFGYNKHITKLVRLSCESPAAGLGSAKAGLGWMY… |
| R1F807 | 1-228 | None |
| A0A7S2SI78 | 7-264 | None |
| A0A0W1KIP0 | 278-512 | None |
| A0A811GC85 | 1-265 | None |
| F0YBX5 | 406-649 | None |
| A0A6A7FV70 | 312-575 | None |
| A0A1F9IMC3 | 46-298 | None |
| A0A6B2KYF3 | 210-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.