DPCstruct | MC39449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 164 ± 15 aa |
| Standard deviation of domain lengths | 15.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4R8Y4 | 22-200 | RVVVRVAHNGQLPPLQPPMDNRSLMLESLWRCVLRPRDPSRLDEVLCRRALDFIARNHALVLRPPVHLLAGPQPRAAPVTRGLQDPG… |
| M7BJG5 | 176-337 | SQLYLRLLVPNIREELRRLLMFMVVASEPEGYTLQKQFDNRSVVIKIFTKAILQNKGLSKTQTELLIQLLMKNHTELFKTPLILLEL… |
| A0A1B6IY62 | 14-177 | None |
| A0A131ZXZ1 | 21-175 | None |
| A0A0G2KKB2 | 229-403 | None |
| A0A7J7IY49 | 481-653 | None |
| A0A6A4KHY8 | 565-723 | None |
| A0A2K6VMF6 | 344-512 | None |
| A0A2G8LCW1 | 20-153 | None |
| A0A2G8L0B8 | 776-953 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.