DPCstruct | MC39447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 9.84 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.97 |
| Pfam Score | 89.29 |
| Assigned Pfam label(s) | CL0279- PF04557 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4R871 | 2-105 | ALEYLKSHPLEPLAVEEFERACGVGIVVTPEQIEETVEGVIKKYKSQLLEERYHFNMGLIMAETRGLLKWADGKILKNEVDVQVLNM… |
| R7Q4E0 | 126-215 | ERVTIDQSEFEEAAGVGVVVTEEEITAAVDSAIQENTPALVEKRYRFNTGLMQRDIMKNLRFAEGKAVSALITEKVAALLGPKTEAD… |
| A0A0N4WJU0 | 106-212 | None |
| A0A2P6S9V4 | 1-91 | None |
| A0A1A9UP05 | 5-112 | None |
| A0A4Y7JEI4 | 281-387 | None |
| A0A287KCS4 | 174-285 | None |
| A0A1R3HRM5 | 94-200 | None |
| A0A453E7S8 | 184-295 | None |
| J9EQJ6 | 13-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.