DPCstruct | MC39446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 136 ± 23 aa |
| Standard deviation of domain lengths | 23.36 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0234 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E4TCB9 | 134-295 | YFVTFAVHHRFISYCLYLMGFVFFVMSLQKGHYRFQFTQFCITHMTLLLVVGQAYFVIRNILNGMYWFFLPASLVITNDIFAYLCGM… |
| S4R7X2 | 22-134 | FGWTHITLLLIVTQSHLVIHNLFEGMIWFVFPMCVVICNDIAAYIFGFFFGRTPLIEVSPKKTWEGFIGGYISTLVFGILLSHVLCG… |
| A0A822D3E3 | 26-168 | None |
| L0AYP7 | 261-394 | None |
| A0A7R9WC93 | 11-117 | None |
| T1FLD7 | 2-109 | None |
| A0A0P1AIR3 | 183-350 | None |
| A0A7R9ADV0 | 95-256 | None |
| A0A7J7L481 | 36-139 | None |
| A0A396ZT60 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.