DPCstruct | MC3943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 109 ± 6 aa |
| Standard deviation of domain lengths | 6.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6ZRC8 | 113-223 | RFFNICLNKLEWLNIAPDLKTNKRSLCNTRLYYKLKTGMWTDIIAESIWKTTQLPCSFNFFYNFVSMSKESQYFLKLKGTCTDCNST… |
| J9MAU8 | 265-373 | FVITFSSDEWKTIQPERVQYNLMDKKRPLLRFKTYEVLPKNKWTPLIAEHFWIHTQLPCCLSFRRAKVLSNGENYVSVVVRCSVCGS… |
| A0A0L7L961 | 113-210 | None |
| J9M0Q9 | 114-223 | None |
| A0A816QC48 | 27-147 | None |
| A0A815HI32 | 27-138 | None |
| J9MAU7 | 106-210 | None |
| X1XT72 | 36-154 | None |
| A0A0J7N7J5 | 16-116 | None |
| X1XFN9 | 74-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.