DPCstruct | MC39429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 318 ± 54 aa |
| Standard deviation of domain lengths | 53.50 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H2RM11 | 11-290 | ERACQVLLICARSNDVNIQIEAFKRIVQKSVKHPKKVRSAFRRVFERRKEISDVTTFSWKRPGVEYSVKWLFWYRLASRCLSSHQSS… |
| A0A0H2S288 | 16-318 | SFPFLDANLRHPSSSISYEYYSEWSSNITASNLPGPGRNLGRFYSLIGRRIEQALERRIVVIAQRKLSSSKGNISDFVSELFRYASS… |
| A0A0H2RTT6 | 28-326 | None |
| A0A0H2RF90 | 38-351 | None |
| A0A0H2RRU1 | 17-292 | None |
| A0A0H2RRT4 | 30-320 | None |
| A0A0H2RQR6 | 3-296 | None |
| A0A0H2RKU7 | 10-320 | None |
| A0A0H2RFE9 | 30-355 | None |
| A0A0H2RDZ9 | 20-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.