DPCstruct | MC39427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 9.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 94.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B5W4V2 | 1-76 | PEDYIWHMSLAMIGLTSQDKAVKKEMLDKMAATDAGKNTLHEGFHKDDPGKYTREWFSWPNMLFCELMLEYYGYKL |
| V9G5Z8 | 11-80 | PPDYIWHMALSMQGITAQTAEEKLEMIAMLEATDAGTGFMHEGFHADDPKVFTRSWFAWSNSLFSQLVYQ |
| A0A813VMG3 | 457-542 | None |
| A0A146HC95 | 409-488 | None |
| A0A179IJV0 | 134-212 | None |
| A0A842BXS1 | 5-86 | None |
| A0A7S1T0Q2 | 267-357 | None |
| R9IZP9 | 2-59 | None |
| C1FZ18 | 966-1059 | None |
| A0A433QHL4 | 55-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.