DPCstruct | MC39425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 174 ± 29 aa |
| Standard deviation of domain lengths | 28.95 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.46 |
| Pfam Score | 54.17 |
| Assigned Pfam label(s) | PF17162- PF17148 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3E747 | 16-166 | LLFLLPLQAVADNETLLDLAVDDQGGKLFLQLGDLPAEYLYIPAIQSGAGSNDLGLDRGKLDRNRRVRFERYGNRILLLEPNLAFRA… |
| A0A7C1QD46 | 17-176 | TIITQAHAAIKSIDEFTTQMNHFPGYYSFFYDTQNGKVYLKVDKFEQQFLLQQSLPYGIGSNDIGLDRGQLGNTHLVQFERFGEKVM… |
| A0A2V7Y8Y7 | 13-199 | None |
| A0A2V8ZVE3 | 3-117 | None |
| A0A7X1ZPC9 | 7-158 | None |
| A0A7C8D7W5 | 27-215 | None |
| W4PF73 | 24-191 | None |
| A0A136LDE5 | 28-215 | None |
| I9HJB9 | 27-175 | None |
| A0A355BQT4 | 2-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.