DPCstruct | MC3942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 488 ± 115 aa |
| Standard deviation of domain lengths | 115.30 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 73.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.07 |
| Pfam Score | 75.17 |
| Assigned Pfam label(s) | CL0661- CL0321- CL0159- CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P4W6Z3 | 149-649 | GALIQAAVVGEEPARIDAGENVNMAVGFFDANELKGRSVEVGGAVYVFPSYCAVLGEPDDCLTNRTVTIGVQMTKWKGAVHGYGGGR… |
| A0A6G0XXI8 | 289-746 | VGITILRVGKNLMETFNEIKGIQIVMPIVSLDLLNFDLSNSKNVISYKRFDNYINLNFKNNDTTERQKQNYSLPVLTQNSNSIKSDR… |
| A0A3M7PUB4 | 316-596 | None |
| A0A6J8DEH9 | 155-711 | None |
| A0A6J8DWY7 | 95-720 | None |
| T1H990 | 115-595 | None |
| A0A6P4ZQX7 | 2-397 | None |
| A0A2T7PD80 | 9-516 | None |
| Q2EG98 | 776-1366 | None |
| A0A1I8IF65 | 259-813 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.