DPCstruct | MC39410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 108 ± 14 aa |
| Standard deviation of domain lengths | 14.30 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17132 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420TMP6 | 5-112 | RYPKAEVAWSEEDFLNPPPEYRGAPLWCWNTKLDRSRLLRQIDQLAEMGIGGFHIHSRVSLDTPYIGAEFMDYIKVLVGAAKTKGLL… |
| A0A2S4GEV7 | 8-97 | KEFAPLSFWAWNEFMDDESICRRIEEFHEEGLRGFFMHSRAGLMTSYLSKEWFHACRTAVKKAEELGMEAWIYDEDGWPSGFAGGLV… |
| A0A3E3IUE5 | 8-101 | None |
| A0A7X7BB80 | 12-127 | None |
| A0A6C2U0X9 | 15-127 | None |
| A0A1H1ZJP5 | 53-155 | None |
| A0A7V2UZT9 | 28-123 | None |
| A0A3N9NRP5 | 37-165 | None |
| A0A0F4YW84 | 350-460 | None |
| A0A0F4YX26 | 6-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.