DPCstruct | MC39405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 350 |
|---|---|
| Mean domain length (aa) | 167 ± 34 aa |
| Standard deviation of domain lengths | 34.44 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.56 |
| Pfam Score | 92.52 |
| Assigned Pfam label(s) | CL0023- CL0125- PF01576- CL0072- PF00773 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4IDW0 | 56-201 | RARQDLGSSGVEDMTLLDDLHEASLLWNLRLRYDKGLIYTFAGSILIAVNPYKMFPDAYGLEVAKQYAGRPLGSLPPHLFAIGAAAH… |
| A0A6E8WCN1 | 9-118 | GVPDMTCISDIDENGINRNLKVRYERDQIYTYTGSILIAVNPYKEIDCYTQEYVAKYHGQKLGLLEPHVFAMAEAAYRNIRDNNTNQ… |
| A0A6I9YH74 | 372-557 | None |
| A0A6P8I7R0 | 6-168 | None |
| A0A7S2XMM1 | 357-502 | None |
| A0A1B0BJE4 | 12-144 | None |
| F4Q2M8 | 448-598 | None |
| A0A811MXY5 | 2-141 | None |
| A0A446JU38 | 130-328 | None |
| A0A7R9PXA8 | 28-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.