DPCstruct | MC39403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 248 ± 12 aa |
| Standard deviation of domain lengths | 12.42 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 67.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4I984 | 1-240 | MAEAQETKDSCSTIKGQRPAEDEEEEVEVEQEQQELLSERWSPLGANYDDANSASSGVDCELEQGLEKSEARRGSTGSELARLRSIE… |
| A0A183ED83 | 1-236 | MMLAEDDVDIAKSPSPPPPVAPSTSDDESVEMERLAPVGESSDELSAVRFGERERFRELEEEQERLNNSLLSLSTHFAQVQFRLKQI… |
| A0A267DEW4 | 41-277 | None |
| A0A6G0HUT2 | 4-256 | None |
| A0A7R9PBB9 | 1-253 | None |
| A0A6V7WTC2 | 1-267 | None |
| A0A1I9G570 | 5-240 | None |
| Q9W5C1 | 3-271 | None |
| A0A673N0X0 | 3-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.