DPCstruct | MC39402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 170 ± 21 aa |
| Standard deviation of domain lengths | 20.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A227JQK2 | 314-481 | VLQAHAVSKTDDDTFEVSLGRGARLVPMSVYRALVKIVVSALDEEHLPDLTKTIEWVRYALHADQPLPKVVMATIYLPPNPSAQITV… |
| A0A352E8Z4 | 24-187 | REPYIPLGVYKALVKIALSTIEDKNELTAFNETIAWLMCPDQTKSVIKPALVIETFIPGPRPTCGVAVSLFRRKPSCSGEPYAIFMI… |
| X0QLG2 | 75-210 | None |
| A0A2Z3R4N1 | 131-313 | None |
| A0A644TH53 | 169-334 | None |
| A0A4P2Q6R9 | 116-292 | None |
| A0A2N3JFY4 | 45-190 | None |
| H8MG87 | 123-326 | None |
| A0A0Q4IR71 | 1-210 | None |
| D8IB44 | 179-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.