DPCstruct | MC39400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 13.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5TSW6 | 80-169 | AALNEYDGSVFYHRTRGELSAQCDKEEMNFLALNLAHDIITGKRTVADARAFYAKTAMAFKQGDRSSPYVQGLIFQTEPSAADPDQP… |
| A0A7Y0K4L3 | 1-95 | MFSELAKFDGSVIVERTRGEISSRCDMEAANILALNMMNDIVTGKLIAEEARDKYCEVTSAFMMNRPAPYAEKLQFDVSQKEKYDTD… |
| A0A7W1C4W7 | 14-112 | None |
| A0A3C1EN78 | 92-183 | None |
| A0A3C1ERW7 | 96-198 | None |
| W1STA9 | 2-79 | None |
| A0A7W1L2Y1 | 169-273 | None |
| A0A4R5A9J1 | 505-604 | None |
| A0A7V9SI00 | 56-144 | None |
| A0A1B9AL25 | 65-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.