DPCstruct | MC3940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 270 |
|---|---|
| Mean domain length (aa) | 167 ± 24 aa |
| Standard deviation of domain lengths | 24.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.62 |
| Pfam Score | 80.53 |
| Assigned Pfam label(s) | CL0023- PF08719- CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9H6W7 | 27-161 | EHAEAQYLPAGAFITSYARQFTIRAAQANYERWLYCDTDSVYLRGTEPPVDMRVDAYELGAWKKEHEFDCFKAIRAKTYCFEEDGEL… |
| A0A6G0WC19 | 30-207 | KATYVGSAILDVSKTFMYDFHYNVMKKNYGRKISSLYSDTDSLIYTIQTKNFFDDLKNDLLSYFDTSNYPKDHYCFSEIHKSQPGFF… |
| A0A6S7IE47 | 390-558 | None |
| A0A5J4VT83 | 43-192 | None |
| A0A5J4VPV6 | 94-237 | None |
| A0A5J4VM00 | 660-844 | None |
| A0A5J4VIQ9 | 85-283 | None |
| E6ZDY5 | 24-228 | None |
| A0A5J4VDC6 | 64-253 | None |
| A0A5J4VAP9 | 2-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.