DPCstruct | MC39397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 80 ± 13 aa |
| Standard deviation of domain lengths | 13.09 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6I8R6 | 1-69 | MGLRFQRRIRLFKGVYLNLSKTGVSFSLRGRGGGITVGKRGPRASVGIPGTGLSYQTKLGSGGGVIGIV |
| A0A3M1HPK2 | 10-73 | AYLRFYRRIPIIPGILYLNLSKSGVSITLGRRGLTITLGKRGLRTTVGVPGTGVSVSETWPKKR |
| A0A7X1NDV8 | 1-57 | None |
| A0A3M0SC37 | 1-97 | None |
| A0A8B3DK91 | 1-88 | None |
| A0A6I3BGS0 | 1-87 | None |
| A0A656HGS5 | 1-74 | None |
| A0A2T7BP13 | 1-132 | None |
| A0A847PLF4 | 2-66 | None |
| A0A7Y6CNF1 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.