DPCstruct | MC39396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 187 ± 28 aa |
| Standard deviation of domain lengths | 27.87 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.76 |
| Pfam Score | 46.43 |
| Assigned Pfam label(s) | PF19425- CL0105- CL0187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6I832 | 2-187 | LETGDTLTTLFARLGLTDTEALRFLRSSPKTRPFVHPQPGQFVTAGVFEDGRIAFLHLYMEGPHDADSRRVEIRREGTIFTASVEPF… |
| A0A0B8Q309 | 52-224 | PAPTYSYHIKRGDNLSVVFSRLGFAYSDLTKIMEEDLNHLALDTLKPGNTLKFWADDETGKLAKMELEFNPADRVQYTRTDDDTFTF… |
| A0A2V7KLY3 | 6-182 | None |
| A0A842JAF4 | 3-192 | None |
| A0A4Y9EME4 | 123-335 | None |
| A0A377D5M5 | 1-145 | None |
| A0A3D5Y1F3 | 330-526 | None |
| A0A2G1YUN4 | 36-223 | None |
| A0A2E2EJZ9 | 67-264 | None |
| A0A1E3VXH9 | 7-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.