DPCstruct | MC39393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 121 ± 18 aa |
| Standard deviation of domain lengths | 18.10 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K4DV58 | 170-256 | VPPSADAEVLAFVNDPLVTEDVLDDQVGLTGQSAAAIIGHRNGPDGEFGTADDDLFDTVEELDAVPYVGPASMEKIFAFAPLWAVLP |
| A0A7W0ZSX0 | 4-122 | ATLIALSLVAATGCISDEAEDGENDVGLSDGKADGAMLTDCEKAAIVSYINDGVTAAALQAAGVHSRAAKNLTSIRDGNDRRFGTAD… |
| A0A2E7ULW8 | 8-125 | None |
| A0A2E7M835 | 10-135 | None |
| A0A5B8XWW4 | 7-140 | None |
| A0A5B8XSM6 | 1-133 | None |
| A0A7V9TG14 | 522-600 | None |
| A0A1M3NB05 | 14-128 | None |
| A0A1M3MSR5 | 9-138 | None |
| A0A7W0Y6S7 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.