DPCstruct | MC39392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 242 |
|---|---|
| Mean domain length (aa) | 100 ± 13 aa |
| Standard deviation of domain lengths | 13.05 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 15.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1D948 | 103-201 | ASVPRAKTLSFAPNSRVQRQKDVAWRIIDGEAVIVSPADSLMHTLNDVGTRIWELLAGDKTLKEVAEILCAEFEVDPKRAEQDTIWF… |
| A0A7C5U138 | 17-106 | EKYMNMRDTKPMRRGNFLGVERDKFYVAVSEEEVYELSPLAYYVWSLCDGEHSVRDIALDISNNANVPYHEVVEPLLIVLEQMQKAG… |
| A0A538QCA0 | 5-112 | None |
| A0A2V7Y5X1 | 4-107 | None |
| A0A157ZLD8 | 5-93 | None |
| A0A7T1HWD5 | 4-102 | None |
| A0A841KA65 | 1-88 | None |
| A0A536WEC2 | 1-119 | None |
| A0A1T5K8R9 | 1-86 | None |
| A0A5Q4GAH8 | 29-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.