DPCstruct | MC39390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 74 ± 16 aa |
| Standard deviation of domain lengths | 15.56 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K1QA44 | 3-53 | DFRQYRVSEIFNEGDLVKHSKFGEGVVTRILDQRKVEILFKDEPRTLAQGL |
| A0A3M1CYN7 | 14-82 | MPPPRNKAWEEAARDVDLSSAVPYRPQERYEVGQVIEHPKYGIGIVRGVKGNLAYVVFHDTIRKLAMGR |
| A0A3D1QXZ7 | 5-60 | None |
| A0A7X7XE56 | 223-313 | None |
| A0A367ZDM3 | 27-103 | None |
| A0A7Y4ZQQ9 | 184-249 | None |
| A0A7W0NPZ9 | 37-106 | None |
| A0A2Z4FI43 | 25-94 | None |
| F8CDD6 | 54-142 | None |
| A0A521U8C6 | 53-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.