DPCstruct | MC39389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 451 |
|---|---|
| Mean domain length (aa) | 116 ± 20 aa |
| Standard deviation of domain lengths | 20.29 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.02 |
| Pfam Score | 98.74 |
| Assigned Pfam label(s) | CL0080- PF10238- CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A382DBQ9 | 6-116 | TYNITRKSGTEQPFTGKYLNEKSKGIYNCVCCDNELFSSDTKFDSKSGWPSFYDVINNENISHIKDSSHGMNRIEVLCSKCDAHLGH… |
| A0A2G2DKV1 | 2-96 | YCKACAQAITTIDQQLTVNTSFRHTFFNPTGIVFQLGCYKKAHGCEAVGVPSSEFSWFNGYLWTFALCSGCQSHLGWFFDSGSSSFW… |
| A0A6I8VCB9 | 67-168 | None |
| B0S6J4 | 10-119 | None |
| A0A7R9L6F6 | 98-185 | None |
| A0A7S2SVP3 | 24-139 | None |
| A0A7S0LYC4 | 2-98 | None |
| A0A1X6PJA1 | 54-184 | None |
| A0A7S4SEX1 | 23-131 | None |
| A0A0C2JIJ6 | 2-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.