DPCstruct | MC39388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Standard deviation of domain lengths | 5.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6XE64 | 1-48 | MKCSICGHKIKADLNGWTGGHNPWPVNEGKCCGECNDEVVIPRRLHDY |
| A0A382D4T9 | 9-62 | MKCSICNGTIEPLIDPKSGKTIWDQGHNAEPVAEGRACDSCNSTIVLATRLKRA |
| A0A1Z9B1P5 | 1-63 | None |
| A0A0F9RMU9 | 1-50 | None |
| A0A2D6PCP4 | 169-228 | None |
| A0A2D6X1D8 | 1-58 | None |
| A0A2D6PI79 | 25-85 | None |
| X0RN14 | 19-70 | None |
| A0A2D5GW13 | 26-84 | None |
| A0A2E1ZBE8 | 9-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.